CAT. NO.: APE-017
| Product Details | |
|---|---|
| Alternate Name | Urogastrone, URG, EGF, epidermal growth factor |
| Gene Symbol | EGF |
| Gene ID | 6075 |
| Source | E. coli |
| Appearance | Lyophilized protein |
| Physical Form Description | Lyophilized from PBS, pH 7.4 |
| Molecular Weight | 6.151 kDa |
| Purity by SDS-PAGE | ≥98% |
| Amino Acid Sequence | NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR |
| Handling | Centrifuge the vial prior to opening. |
| Storage Conditions | -20°C |
| Description | |
|---|---|
| Epidermal growth factor has a profound effect on the differentiation of specific cells in vivo and is a potent mitogenic factor for a variety of cultured cells of both ectodermal and mesodermal origin. The EGF precursor is believed to exist as a membrane-bound molecule which is proteolytically cleaved to generate the 53-amino acid peptide hormone that stimulates cells to divide. EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Epidermal Growth Factor Rat Recombinant produced in E.Coliis a single, non-glycosylated, polypeptide chain containing 53 amino acids and having a molecular mass of 6151 Dalton. The Rat EGF is purified by proprietary chromatographic techniques. | |
Our customers have direct access to our experts and give timely feedback to any online inquiries. If you are interested in our products, please contact us.
All of our services and products are intended for preclinical research use only and cannot be used to diagnose, treat or manage patients.
CD BioScience is a research service provider focused on aging research, specializing in providing research on aging mechanisms, preclinical drug discovery and development, and the development of healthcare and skincare products.
Copyright © 2024 CD BioSciences. All rights reserved.